Lineage for d2p7md_ (2p7m D:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1023238Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 1023239Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 1023274Family d.32.1.2: Antibiotic resistance proteins [54598] (8 proteins)
    duplication: consists of two clear structural repeats each having this fold
    subunit fold and dimeric assembly are similar to those of glyoxalase
  6. 1023339Protein automated matches [190190] (4 species)
    not a true protein
  7. 1023340Species Listeria monocytogenes [TaxId:169963] [187361] (5 PDB entries)
  8. 1023346Domain d2p7md_: 2p7m D: [167061]
    automated match to d1r9ca_

Details for d2p7md_

PDB Entry: 2p7m (more details), 1.85 Å

PDB Description: Crystal structure of monoclinic form of genomically encoded fosfomycin resistance protein, FosX, from Listeria monocytogenes at pH 6.5
PDB Compounds: (D:) Glyoxalase family protein

SCOPe Domain Sequences for d2p7md_:

Sequence, based on SEQRES records: (download)

>d2p7md_ d.32.1.2 (D:) automated matches {Listeria monocytogenes [TaxId: 169963]}
misglshitlivkdlnkttaflqnifnaeeiyssgdktfslskekffliaglwicimegd
slqertynhiafqiqseevdeyterikalgvemkperprvqgegrsiyfydfdnhlfelh
agtleerlkry

Sequence, based on observed residues (ATOM records): (download)

>d2p7md_ d.32.1.2 (D:) automated matches {Listeria monocytogenes [TaxId: 169963]}
misglshitlivkdlnkttaflqnifnaeeiyssgdkekffliaglwicimegdslqert
ynhiafqiqseevdeyterikalgvemkperprvqgegrsiyfydfdnhlfelhagtlee
rlkry

SCOPe Domain Coordinates for d2p7md_:

Click to download the PDB-style file with coordinates for d2p7md_.
(The format of our PDB-style files is described here.)

Timeline for d2p7md_: