| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) ![]() |
| Family d.32.1.2: Antibiotic resistance proteins [54598] (8 proteins) duplication: consists of two clear structural repeats each having this fold subunit fold and dimeric assembly are similar to those of glyoxalase |
| Protein automated matches [190190] (4 species) not a true protein |
| Species Listeria monocytogenes [TaxId:169963] [187361] (5 PDB entries) |
| Domain d2p7mc_: 2p7m C: [167060] automated match to d1r9ca_ |
PDB Entry: 2p7m (more details), 1.85 Å
SCOPe Domain Sequences for d2p7mc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p7mc_ d.32.1.2 (C:) automated matches {Listeria monocytogenes [TaxId: 169963]}
misglshitlivkdlnkttaflqnifnaeeiyssgdktfslskekffliaglwicimegd
slqertynhiafqiqseevdeyterikalgvemkperprvqgegrsiyfydfdnhlfelh
agtleerlk
Timeline for d2p7mc_: