SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2p7lc_ (2p7l C:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2166686Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2166687Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2166741Family d.32.1.2: Antibiotic resistance proteins [54598] (8 protein domains)
    duplication: consists of two clear structural repeats each having this fold
    subunit fold and dimeric assembly are similar to those of glyoxalase
  6. 2166806Protein automated matches [190190] (5 species)
    not a true protein
  7. 2166807Species Listeria monocytogenes [TaxId:169963] [187361] (5 PDB entries)
  8. 2166824Domain d2p7lc_: 2p7l C: [167054]
    automated match to d1r9ca_
    complexed with gol

Details for d2p7lc_

PDB Entry: 2p7l (more details), 2.2 Å

PDB Description: Crystal structure of monoclinic form of genomically encoded fosfomycin resistance protein, FosX, from Listeria monocytogenes at pH 5.75
PDB Compounds: (C:) Glyoxalase family protein

SCOPe Domain Sequences for d2p7lc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p7lc_ d.32.1.2 (C:) automated matches {Listeria monocytogenes [TaxId: 169963]}
misglshitlivkdlnkttaflqnifnaeeiyssgdktfslskekffliaglwicimegd
slqertynhiafqiqseevdeyterikalgvemkperprvqgegrsiyfydfdnhlfelh
agtleerlk

SCOPe Domain Coordinates for d2p7lc_:

Click to download the PDB-style file with coordinates for d2p7lc_.
(The format of our PDB-style files is described here.)

Timeline for d2p7lc_: