SCOPe 2.06: Domain d2p6za_: 2p6z A:

Lineage for d2p6za_ (2p6z A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.5: RNase A-like [54075] (1 superfamily)
   contains long curved beta-sheet and 3 helices

4. Superfamily d.5.1: RNase A-like [54076] (2 families)
   can be classified as disulfide-rich

5. Family d.5.1.0: automated matches [191478] (1 protein)
   not a true family

6. Protein automated matches [190767] (6 species)
   not a true protein

7. Species Frog (Rana pipiens) [TaxId:8404] [187984] (2 PDB entries)

8. Domain d2p6za_: 2p6z A: [167040]
   automated match to d1bc4a_
   complexed with cit, na

Details for d2p6za_

PDB Entry: 2p6z, 1.93 Å

PDB Description: enzymatic and structural characterisation of amphinase, a novel cytotoxic ribonuclease from rana pipiens oocytes

PDB Compounds: (A:) Recombinant Amphinase-2

SCOPe Domain Sequences for d2p6za_:

Sequence; same for both SEQRES and ATOM records:

>d2p6za_ d.5.1.0 (A:) automated matches {Frog (Rana pipiens) [TaxId: 8404]}
kedrewekfktkhitsqsvadfncnrtmndpaytpdgqckpintfihsttgpvkeicrra
tgrvnksstqqftlttcknpirckysqsnttnficitcrdnypvhfvktgkc

Timeline for d2p6za_:

• d2p6za_ first appeared in SCOPe 2.01
  
• d2p6za_ appears in SCOPe 2.05
  
• d2p6za_ appears in SCOPe 2.07
  
• d2p6za_ appears in the current release, SCOPe 2.08