SCOPe 2.08: Domain d2p6cb_: 2p6c B:

Lineage for d2p6cb_ (2p6c B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.273: YjbQ-like [111037] (1 superfamily)
   beta(2)-alpha-beta(2)-alpha(2)-beta(3); contains a beta-sandwich: 7 strands in 2 sheets; trimerizes with orthogonally packed beta-sheets

4. Superfamily d.273.1: YjbQ-like [111038] (2 families)

5. Family d.273.1.1: YjbQ-like [111039] (5 proteins)
   Pfam PF01894

6. Protein automated matches [190765] (1 species)
   not a true protein

7. Species Aquifex aeolicus [TaxId:224324] [187982] (1 PDB entry)

8. Domain d2p6cb_: 2p6c B: [167026]
   automated match to d1vmja_
   complexed with po4

Details for d2p6cb_

PDB Entry: 2p6c, 2 Å

PDB Description: Crystal structure of hypothetical protein aq_2013 from Aquifex aeolicus VF5.

PDB Compounds: (B:) aq_2013 protein

SCOPe Domain Sequences for d2p6cb_:

Sequence; same for both SEQRES and ATOM records:

>d2p6cb_ d.273.1.1 (B:) automated matches {Aquifex aeolicus [TaxId: 224324]}
mkaytkyltfntkkrreliritdevkkaveesevkeglclvssmhltssviiqddeeglh
ediwewleklapyrpdykhhrtgedngdahlknllthlqvvlpitngkldlgpwqeifya
efdgqrpkrvvikiige

Timeline for d2p6cb_:

• d2p6cb_ first appeared in SCOPe 2.01
  
• d2p6cb_ appears in SCOPe 2.07