SCOPe 2.03: Domain d2p5qa_: 2p5q A:

Lineage for d2p5qa_ (2p5q A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (107 species)
   not a true protein

7. Species Populus trichocarpa [TaxId:3695] [187360] (4 PDB entries)

8. Domain d2p5qa_: 2p5q A: [167016]
   automated match to d2f8aa1
   complexed with act, cd

Details for d2p5qa_

PDB Entry: 2p5q, 2 Å

PDB Description: crystal structure of the poplar glutathione peroxidase 5 in the reduced form

PDB Compounds: (A:) Glutathione peroxidase 5

SCOPe Domain Sequences for d2p5qa_:

Sequence; same for both SEQRES and ATOM records:

>d2p5qa_ c.47.1.0 (A:) automated matches {Populus trichocarpa [TaxId: 3695]}
esvhdftvkdakendvdlsifkgkvllivnvaskcgmtnsnyaemnqlyekykdqgleil
afpcnqfgeeepgtndqitdfvctrfksefpifdkidvngenasplyrflklgkwgifgd
diqwnfakflvnkdgqvvdryypttsplslerdikqlleis

Timeline for d2p5qa_:

• d2p5qa_ first appeared in SCOPe 2.01
  
• d2p5qa_ appears in SCOPe 2.02
  
• d2p5qa_ appears in SCOPe 2.04
  
• d2p5qa_ appears in the current release, SCOPe 2.08