Lineage for d2p5da1 (2p5d A:4-147)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2076966Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 2076967Superfamily b.122.1: PUA domain-like [88697] (14 families) (S)
  5. 2077103Family b.122.1.8: Atu2648/PH1033-like [141703] (7 protein domains)
    Pfam PF01878; DUF55
  6. 2077124Protein automated matches [190653] (2 species)
    not a true protein
  7. 2077125Species Methanocaldococcus jannaschii [TaxId:2190] [187980] (1 PDB entry)
  8. 2077126Domain d2p5da1: 2p5d A:4-147 [167011]
    Other proteins in same PDB: d2p5da2
    automated match to d1wmma1

Details for d2p5da1

PDB Entry: 2p5d (more details), 1.7 Å

PDB Description: Crystal structure of MJECL36 from Methanocaldococcus jannaschii DSM 2661
PDB Compounds: (A:) UPF0310 protein MJECL36

SCOPe Domain Sequences for d2p5da1:

Sequence, based on SEQRES records: (download)

>d2p5da1 b.122.1.8 (A:4-147) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}
maywlcitnednwkvikekkiwgvaerykntinkvkvgdkliiyeiqrsgkdykppyirg
vyevvsevykdsskifkptprnpnekfpyrvklkeikvfeppinfkelipklkfitnkkr
wsghlmgkamreipeedyklivgn

Sequence, based on observed residues (ATOM records): (download)

>d2p5da1 b.122.1.8 (A:4-147) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}
maywlcitnednwkvikekkiwgvaerykntinkvkvgdkliiyeiqrsgkdykppyirg
vyevvsevykdsskifkptprnpnekfpyrvklkeikvfeppinfkelipklkfitnkkr
wsgmgkamreipeedyklivgn

SCOPe Domain Coordinates for d2p5da1:

Click to download the PDB-style file with coordinates for d2p5da1.
(The format of our PDB-style files is described here.)

Timeline for d2p5da1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2p5da2