Lineage for d2p5cb_ (2p5c B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2911790Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily)
    consists of two non-similar domains
    Domain 1 has parallel sheet of 5 strands, order 32415
    Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest
  4. 2911791Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families) (S)
  5. 2911792Family c.90.1.1: Tetrapyrrole methylase [53791] (8 proteins)
    Pfam PF00590
  6. 2911797Protein Diphthine synthase, DphB [102684] (3 species)
    diphthamide biosynthesis methyltransferase
  7. 2911803Species Pyrococcus horikoshii [TaxId:53953] [142779] (80 PDB entries)
    Uniprot O58456 1-265
  8. 2911931Domain d2p5cb_: 2p5c B: [167010]
    automated match to d1vcea1
    complexed with gol, sah

Details for d2p5cb_

PDB Entry: 2p5c (more details), 2.4 Å

PDB Description: crystal structure of ph0725 from pyrococcus horikoshii ot3
PDB Compounds: (B:) diphthine synthase

SCOPe Domain Sequences for d2p5cb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p5cb_ c.90.1.1 (B:) Diphthine synthase, DphB {Pyrococcus horikoshii [TaxId: 53953]}
mvlyfiglglyderditvkgleiakkcdyvfaefytslmagttlgriqkligkeirvlsr
edvelnfenivlplakendvafltpgdpmvatthaelrirakragvesyvihapsiysav
gitglhiykfgksatvaypegnwfptsyydvikenaerglhtllfldikaekrmymtane
amelllkvedmkkggvftddtlvvvlaragslnptiragyvkdliredfgdpphilivpg
klhiveaeylveiagapreilrvnv

SCOPe Domain Coordinates for d2p5cb_:

Click to download the PDB-style file with coordinates for d2p5cb_.
(The format of our PDB-style files is described here.)

Timeline for d2p5cb_: