Lineage for d1mfrj_ (1mfr J:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2700839Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2700840Protein (Apo)ferritin [47246] (8 species)
  7. 2700841Species Bullfrog (Rana catesbeiana) [TaxId:8400] [47249] (21 PDB entries)
  8. 2700870Domain d1mfrj_: 1mfr J: [16701]
    complexed with mg

Details for d1mfrj_

PDB Entry: 1mfr (more details), 2.8 Å

PDB Description: crystal structure of m ferritin
PDB Compounds: (J:) m ferritin

SCOPe Domain Sequences for d1mfrj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mfrj_ a.25.1.1 (J:) (Apo)ferritin {Bullfrog (Rana catesbeiana) [TaxId: 8400]}
vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheere
haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk
vdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsv

SCOPe Domain Coordinates for d1mfrj_:

Click to download the PDB-style file with coordinates for d1mfrj_.
(The format of our PDB-style files is described here.)

Timeline for d1mfrj_: