Lineage for d2p56a_ (2p56 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2151564Fold c.130: Alpha-2,3/8-sialyltransferase CstII [102413] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 8 strands, order 54321678
  4. 2151565Superfamily c.130.1: Alpha-2,3/8-sialyltransferase CstII [102414] (2 families) (S)
  5. 2151584Family c.130.1.0: automated matches [191366] (1 protein)
    not a true family
  6. 2151585Protein automated matches [190441] (1 species)
    not a true protein
  7. 2151586Species Campylobacter jejuni [TaxId:197] [187343] (2 PDB entries)
  8. 2151588Domain d2p56a_: 2p56 A: [167008]
    automated match to d1ro7a_
    complexed with edo

Details for d2p56a_

PDB Entry: 2p56 (more details), 2.2 Å

PDB Description: crystal structure of alpha-2,3-sialyltransferase from campylobacter jejuni in apo form
PDB Compounds: (A:) Alpha-2,3-sialyltransferase

SCOPe Domain Sequences for d2p56a_:

Sequence, based on SEQRES records: (download)

>d2p56a_ c.130.1.0 (A:) automated matches {Campylobacter jejuni [TaxId: 197]}
rmenelivsknmqniiiagngpslkninykrlpreydvfrcnqfyfedkyylgkkikavf
fnpgvflqqyhtakqlilkneyeiknifcstfnlpfiesndflhqfynffpdaklgyevi
enlkefyayikyneiyfnkritsgvymcaiaialgyktiylcgidfyegdviypfeamst
niktifpgikdfkpsnchskeydiealkllksiykvniyalcddsilanhfplsininnn
ftlenkhnnsindilltdntpgvsfyknqlkadn

Sequence, based on observed residues (ATOM records): (download)

>d2p56a_ c.130.1.0 (A:) automated matches {Campylobacter jejuni [TaxId: 197]}
rmenelivsknmqniiiagngpslkninykrlpreydvfrcnqfyfedkyylgkkikavf
fnpgvflqqyhtakqlilkneyeiknifcstfnlpfiesndflhqfynffpdaklgyevi
enlkefyayikyneiyfnkritsgvymcaiaialgyktiylcgidfmstniktifpginc
hskeydiealkllksiykvniyalcddsilanhfplsininnnftlenkhnnsindillt
dntpgvsfyknqlkadn

SCOPe Domain Coordinates for d2p56a_:

Click to download the PDB-style file with coordinates for d2p56a_.
(The format of our PDB-style files is described here.)

Timeline for d2p56a_: