SCOPe 2.02: Domain d2p4ud_: 2p4u D:

Lineage for d2p4ud_ (2p4u D:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (2 superfamilies)
   3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families)
   share the common active site structure with the family II

5. Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (3 proteins)

6. Protein Tyrosine phosphatase [52790] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [187979] (1 PDB entry)

8. Domain d2p4ud_: 2p4u D: [167006]
   automated match to d1bvha_
   complexed with po4

Details for d2p4ud_

PDB Entry: 2p4u, 1.9 Å

PDB Description: crystal structure of acid phosphatase 1 (acp1) from mus musculus

PDB Compounds: (D:) Acid phosphatase 1

SCOPe Domain Sequences for d2p4ud_:

Sequence; same for both SEQRES and ATOM records:

>d2p4ud_ c.44.1.1 (D:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]}
sksvlfvclgnicrspiaeavfrklvtdekvsdnwaidssavsdwnvgrppdpravsclr
nhgistahkarqitkedfatfdyilcmdesnlrdlnrksnqvknckakiellgsydpqkq
liiedpyygndsdfevvyqqclrcckaflekty

Timeline for d2p4ud_:

• d2p4ud_ first appeared in SCOPe 2.01
  
• d2p4ud_ appears in SCOPe 2.03
  
• d2p4ud_ appears in the current release, SCOPe 2.08