Lineage for d2p4ua_ (2p4u A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2874827Fold c.44: Phosphotyrosine protein phosphatases I-like [52787] (3 superfamilies)
    3 layers: a/b/a; parallel beta-sheet of 4 strands, order 2134
  4. 2874828Superfamily c.44.1: Phosphotyrosine protein phosphatases I [52788] (2 families) (S)
    share the common active site structure with the family II
  5. 2874829Family c.44.1.1: Low-molecular-weight phosphotyrosine protein phosphatases [52789] (3 proteins)
    automatically mapped to Pfam PF01451
  6. 2874853Protein Tyrosine phosphatase [52790] (5 species)
  7. 2874887Species Mouse (Mus musculus) [TaxId:10090] [187979] (2 PDB entries)
  8. 2874888Domain d2p4ua_: 2p4u A: [167003]
    automated match to d1bvha_
    complexed with po4

Details for d2p4ua_

PDB Entry: 2p4u (more details), 1.9 Å

PDB Description: crystal structure of acid phosphatase 1 (acp1) from mus musculus
PDB Compounds: (A:) Acid phosphatase 1

SCOPe Domain Sequences for d2p4ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p4ua_ c.44.1.1 (A:) Tyrosine phosphatase {Mouse (Mus musculus) [TaxId: 10090]}
sksvlfvclgnicrspiaeavfrklvtdekvsdnwaidssavsdwnvgrppdpravsclr
nhgistahkarqitkedfatfdyilcmdesnlrdlnrksnqvknckakiellgsydpqkq
liiedpyygndsdfevvyqqclrcckaflekty

SCOPe Domain Coordinates for d2p4ua_:

Click to download the PDB-style file with coordinates for d2p4ua_.
(The format of our PDB-style files is described here.)

Timeline for d2p4ua_: