Lineage for d2p4ta_ (2p4t A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1535986Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1536816Superfamily b.34.4: Electron transport accessory proteins [50090] (5 families) (S)
  5. 1536817Family b.34.4.1: R67 dihydrofolate reductase [50091] (2 proteins)
  6. 1536822Protein automated matches [190309] (1 species)
    not a true protein
  7. 1536823Species Escherichia coli [TaxId:562] [187228] (6 PDB entries)
  8. 1536826Domain d2p4ta_: 2p4t A: [167002]
    automated match to d1viea_
    complexed with nap; mutant

Details for d2p4ta_

PDB Entry: 2p4t (more details), 1.15 Å

PDB Description: structure of the q67h mutant of r67 dihydrofolate reductase-nadp+ complex reveals a novel cofactor binding mode
PDB Compounds: (A:) Dihydrofolate reductase type 2

SCOPe Domain Sequences for d2p4ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p4ta_ b.34.4.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
natfgmgdrvrkksgaawqgqivgwyctnltpegyaveseahpgsvhiypvaalerin

SCOPe Domain Coordinates for d2p4ta_:

Click to download the PDB-style file with coordinates for d2p4ta_.
(The format of our PDB-style files is described here.)

Timeline for d2p4ta_: