Lineage for d2p3xa_ (2p3x A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002034Fold a.86: Di-copper centre-containing domain [48055] (1 superfamily)
    multihelical
  4. 2002035Superfamily a.86.1: Di-copper centre-containing domain [48056] (4 families) (S)
    duplication: contains two structural repeats
  5. 2002059Family a.86.1.2: Catechol oxidase [48061] (2 protein domains)
  6. 2002069Protein automated matches [190909] (2 species)
    not a true protein
  7. 2002070Species Grape (Vitis vinifera) [TaxId:29760] [188369] (1 PDB entry)
  8. 2002071Domain d2p3xa_: 2p3x A: [167000]
    automated match to d1bt1a_
    complexed with c2o

Details for d2p3xa_

PDB Entry: 2p3x (more details), 2.2 Å

PDB Description: Crystal structure of Grenache (Vitis vinifera) Polyphenol Oxidase
PDB Compounds: (A:) Polyphenol oxidase, chloroplast

SCOPe Domain Sequences for d2p3xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p3xa_ a.86.1.2 (A:) automated matches {Grape (Vitis vinifera) [TaxId: 29760]}
apiqapdiskcgtatvpdgvtptnccppvttkiidfqlpssgspmrtrpaahlvskeyla
kykkaielqkalpdddprsfkqqanvhctycqgaydqvgytdlelqvhaswlflpfhryy
lyfnerilakliddptfalpywawdnpdgmymptiyasspsslydekrnakhlpptvidl
dydgteptipddelktdnlaimykqivsgattpklflgypyragdaidpgagtlehaphn
ivhkwtgladkpsedmgnfytagrdpiffghhanvdrmwniwktiggknrkdftdtdwld
atfvfydenkqlvkvkvsdcvdtsklryqyqdipipwlp

SCOPe Domain Coordinates for d2p3xa_:

Click to download the PDB-style file with coordinates for d2p3xa_.
(The format of our PDB-style files is described here.)

Timeline for d2p3xa_: