Lineage for d2p3wb_ (2p3w B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 948106Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 948107Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 948564Family b.36.1.0: automated matches [191362] (1 protein)
    not a true family
  6. 948565Protein automated matches [190436] (3 species)
    not a true protein
  7. 948566Species Human (Homo sapiens) [TaxId:9606] [187333] (15 PDB entries)
  8. 948577Domain d2p3wb_: 2p3w B: [166999]
    automated match to d2pzda1

Details for d2p3wb_

PDB Entry: 2p3w (more details), 1.7 Å

PDB Description: crystal structure of the htra3 pdz domain bound to a phage-derived ligand (fgrwv)
PDB Compounds: (B:) Probable serine protease HTRA3

SCOPe Domain Sequences for d2p3wb_:

Sequence, based on SEQRES records: (download)

>d2p3wb_ b.36.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gshmkrfigirmrtitpslvdelkasnpdfpevssgiyvqevapnspsqrggiqdgdiiv
kvngrplvdsselqeavltesplllevrrgnddllfsiapevvmgggfgrwv

Sequence, based on observed residues (ATOM records): (download)

>d2p3wb_ b.36.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gshmkrfigirmrtitpslvdepevssgiyvqevapnspsqrggiqdgdiivkvngrplv
dsselqeavltesplllevrrgnddllfsiapevvmgggfgrwv

SCOPe Domain Coordinates for d2p3wb_:

Click to download the PDB-style file with coordinates for d2p3wb_.
(The format of our PDB-style files is described here.)

Timeline for d2p3wb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2p3wa_