Lineage for d2p3wb1 (2p3w B:354-453)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785883Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2785884Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2786490Family b.36.1.0: automated matches [191362] (1 protein)
    not a true family
  6. 2786491Protein automated matches [190436] (9 species)
    not a true protein
  7. 2786505Species Human (Homo sapiens) [TaxId:9606] [187333] (104 PDB entries)
  8. 2786586Domain d2p3wb1: 2p3w B:354-453 [166999]
    Other proteins in same PDB: d2p3wa2, d2p3wa3, d2p3wb2, d2p3wb3
    automated match to d2pzda1

Details for d2p3wb1

PDB Entry: 2p3w (more details), 1.7 Å

PDB Description: crystal structure of the htra3 pdz domain bound to a phage-derived ligand (fgrwv)
PDB Compounds: (B:) Probable serine protease HTRA3

SCOPe Domain Sequences for d2p3wb1:

Sequence, based on SEQRES records: (download)

>d2p3wb1 b.36.1.0 (B:354-453) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krfigirmrtitpslvdelkasnpdfpevssgiyvqevapnspsqrggiqdgdiivkvng
rplvdsselqeavltesplllevrrgnddllfsiapevvm

Sequence, based on observed residues (ATOM records): (download)

>d2p3wb1 b.36.1.0 (B:354-453) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krfigirmrtitpslvdepevssgiyvqevapnspsqrggiqdgdiivkvngrplvdsse
lqeavltesplllevrrgnddllfsiapevvm

SCOPe Domain Coordinates for d2p3wb1:

Click to download the PDB-style file with coordinates for d2p3wb1.
(The format of our PDB-style files is described here.)

Timeline for d2p3wb1: