Lineage for d2p3ja_ (2p3j A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780402Family b.29.1.14: vp4 sialic acid binding domain [74907] (2 proteins)
    automatically mapped to Pfam PF00426
  6. 2780403Protein vp4 sialic acid binding domain [74908] (1 species)
  7. 2780404Species Rhesus rotavirus [TaxId:10969] [74909] (6 PDB entries)
  8. 2780408Domain d2p3ja_: 2p3j A: [166997]
    automated match to d1kqra_
    complexed with mna, so4; mutant

Details for d2p3ja_

PDB Entry: 2p3j (more details), 1.9 Å

PDB Description: crystal structure of the arg101ala mutant protein of rhesus rotavirus vp8*
PDB Compounds: (A:) vp4

SCOPe Domain Sequences for d2p3ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p3ja_ b.29.1.14 (A:) vp4 sialic acid binding domain {Rhesus rotavirus [TaxId: 10969]}
vldgpyqpttfnppvdywmllaptaagvvvegtnntdawlatilvepnvtsetrsytlfg
tqeqitianasqtqwkfidvvkttqngsysqygplqstpklyavmkhngkiytyngetpn
vttkyysttnydsvnmtafcdfyiipreeestcteyinngl

SCOPe Domain Coordinates for d2p3ja_:

Click to download the PDB-style file with coordinates for d2p3ja_.
(The format of our PDB-style files is described here.)

Timeline for d2p3ja_: