Class b: All beta proteins [48724] (177 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.1: Cytokine [50353] (3 families) |
Family b.42.1.0: automated matches [191477] (1 protein) not a true family |
Protein automated matches [190764] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187978] (6 PDB entries) |
Domain d2p39a_: 2p39 A: [166990] automated match to d1pwaa_ complexed with scr |
PDB Entry: 2p39 (more details), 1.5 Å
SCOPe Domain Sequences for d2p39a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p39a_ b.42.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} spllgsswgglihlytatarnsyhlqihknghvdgaphqtiysalmirsedagfvvitgv msrrylcmdfrgnifgshyfdpencrfqhqtlengydvyhspqyhflvslgrakraflpg mnpppysqflsrrneiplihfn
Timeline for d2p39a_: