Lineage for d2p39a_ (2p39 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2061457Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2061458Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 2061865Family b.42.1.0: automated matches [191477] (1 protein)
    not a true family
  6. 2061866Protein automated matches [190764] (2 species)
    not a true protein
  7. 2061874Species Human (Homo sapiens) [TaxId:9606] [187978] (6 PDB entries)
  8. 2061875Domain d2p39a_: 2p39 A: [166990]
    automated match to d1pwaa_
    complexed with scr

Details for d2p39a_

PDB Entry: 2p39 (more details), 1.5 Å

PDB Description: crystal structure of human fgf23
PDB Compounds: (A:) Fibroblast growth factor 23

SCOPe Domain Sequences for d2p39a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p39a_ b.42.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
spllgsswgglihlytatarnsyhlqihknghvdgaphqtiysalmirsedagfvvitgv
msrrylcmdfrgnifgshyfdpencrfqhqtlengydvyhspqyhflvslgrakraflpg
mnpppysqflsrrneiplihfn

SCOPe Domain Coordinates for d2p39a_:

Click to download the PDB-style file with coordinates for d2p39a_.
(The format of our PDB-style files is described here.)

Timeline for d2p39a_: