SCOPe 2.07: Domain d2p37c_: 2p37 C:

Lineage for d2p37c_ (2p37 C:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.1: Legume lectins [49900] (5 proteins)

6. Protein automated matches [190035] (28 species)
   not a true protein

7. Species Canavalia maritima [TaxId:3825] [187574] (6 PDB entries)

8. Domain d2p37c_: 2p37 C: [166988]
   automated match to d1apna_
   complexed with ca, m13, mn

Details for d2p37c_

PDB Entry: 2p37, 2.1 Å

PDB Description: crystal structure of a lectin from canavalia maritima seeds (cml) in complex with man1-3man-ome

PDB Compounds: (C:) concanavalin a

SCOPe Domain Sequences for d2p37c_:

Sequence, based on SEQRES records:

>d2p37c_ b.29.1.1 (C:) automated matches {Canavalia maritima [TaxId: 3825]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvgkr
lsavvsypngdsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfvfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfdatftflikssdshpadgiaffisnidssipsgstgrllglfpdan

Sequence, based on observed residues (ATOM records):

>d2p37c_ b.29.1.1 (C:) automated matches {Canavalia maritima [TaxId: 3825]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvgkr
lsavvsypngdsatvsydvdldnvlpewvrvglsastglyketntilswsftsklkstna
lhfvfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvhiwess
avvasfdatftflikssdshpadgiaffisnidssipsgstgrllglfpdan

Timeline for d2p37c_:

• d2p37c_ first appeared in SCOPe 2.01
  
• d2p37c_ appears in SCOPe 2.06
  
• d2p37c_ appears in the current release, SCOPe 2.08