Lineage for d2p37a_ (2p37 A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 943754Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 943755Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 943756Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 944267Protein automated matches [190035] (15 species)
    not a true protein
  7. 944334Species Canavalia maritima [TaxId:3825] [187574] (6 PDB entries)
  8. 944346Domain d2p37a_: 2p37 A: [166986]
    automated match to d1apna_
    complexed with ca, m13, mn

Details for d2p37a_

PDB Entry: 2p37 (more details), 2.1 Å

PDB Description: crystal structure of a lectin from canavalia maritima seeds (cml) in complex with man1-3man-ome
PDB Compounds: (A:) concanavalin a

SCOPe Domain Sequences for d2p37a_:

Sequence, based on SEQRES records: (download)

>d2p37a_ b.29.1.1 (A:) automated matches {Canavalia maritima [TaxId: 3825]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvgkr
lsavvsypngdsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfvfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfdatftflikssdshpadgiaffisnidssipsgstgrllglfpdan

Sequence, based on observed residues (ATOM records): (download)

>d2p37a_ b.29.1.1 (A:) automated matches {Canavalia maritima [TaxId: 3825]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvgkr
lsavvsypngdsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
nalhfvfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvhiwe
ssavvasfdatftflikssdshpadgiaffisnidssipsgstgrllglfpdan

SCOPe Domain Coordinates for d2p37a_:

Click to download the PDB-style file with coordinates for d2p37a_.
(The format of our PDB-style files is described here.)

Timeline for d2p37a_: