Lineage for d2p34d_ (2p34 D:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2042198Family b.29.1.1: Legume lectins [49900] (5 protein domains)
  6. 2042739Protein automated matches [190035] (27 species)
    not a true protein
  7. 2042830Species Canavalia maritima [TaxId:3825] [187574] (6 PDB entries)
  8. 2042841Domain d2p34d_: 2p34 D: [166985]
    automated match to d1apna_
    complexed with ca, mn

Details for d2p34d_

PDB Entry: 2p34 (more details), 2.1 Å

PDB Description: Crystal structure of a lectin from Canavalia maritima seeds (CML) in complex with man1-4man-OMe
PDB Compounds: (D:) lectin

SCOPe Domain Sequences for d2p34d_:

Sequence, based on SEQRES records: (download)

>d2p34d_ b.29.1.1 (D:) automated matches {Canavalia maritima [TaxId: 3825]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvgkr
lsavvsypngdsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfvfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfdatftflikssdshpadgiaffisnidssipsgstgrllglfpdan

Sequence, based on observed residues (ATOM records): (download)

>d2p34d_ b.29.1.1 (D:) automated matches {Canavalia maritima [TaxId: 3825]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvgkr
lsavvsypngdsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnet
nalhfvfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvhiwe
ssavvasfdatftflikssdshpadgiaffisnidssipsgstgrllglfpdan

SCOPe Domain Coordinates for d2p34d_:

Click to download the PDB-style file with coordinates for d2p34d_.
(The format of our PDB-style files is described here.)

Timeline for d2p34d_: