![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.1: Ferritin [47241] (10 proteins) |
![]() | Protein (Apo)ferritin [47246] (8 species) |
![]() | Species Bullfrog (Rana catesbeiana) [TaxId:8400] [47249] (21 PDB entries) |
![]() | Domain d1mfrg_: 1mfr G: [16698] complexed with mg |
PDB Entry: 1mfr (more details), 2.8 Å
SCOPe Domain Sequences for d1mfrg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mfrg_ a.25.1.1 (G:) (Apo)ferritin {Bullfrog (Rana catesbeiana) [TaxId: 8400]} vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheere haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk vdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsv
Timeline for d1mfrg_: