Lineage for d2p2wa_ (2p2w A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004800Fold a.103: Citrate synthase [48255] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2004801Superfamily a.103.1: Citrate synthase [48256] (2 families) (S)
  5. 2004906Family a.103.1.0: automated matches [191476] (1 protein)
    not a true family
  6. 2004907Protein automated matches [190763] (6 species)
    not a true protein
  7. 2004929Species Thermotoga maritima [TaxId:2336] [187976] (1 PDB entry)
  8. 2004930Domain d2p2wa_: 2p2w A: [166975]
    automated match to d1aj8a_
    complexed with flc

Details for d2p2wa_

PDB Entry: 2p2w (more details), 1.9 Å

PDB Description: Crystal structure of citrate synthase from Thermotoga maritima MSB8
PDB Compounds: (A:) citrate synthase

SCOPe Domain Sequences for d2p2wa_:

Sequence, based on SEQRES records: (download)

>d2p2wa_ a.103.1.0 (A:) automated matches {Thermotoga maritima [TaxId: 2336]}
miqkglegvkicessicyldgingrlyyrgipveelaekstfeetayflwygklptksel
eefkrkmadyrelpaealgilyhlpknlhyidvlkiflsihgsmdgndedlrekairvas
vfptilayyyryskgkelirprkdlshvenfyymmfgernekirllesafillmeqdina
stfaalviastlsdlyscivgalgalkgplhggasekvppmleeigsedrveefvqkclk
ekrkimgfghrvyktydpravflkrvlqehfpdsklfriaskleeyivsnkikniypnvd
lyssvlfeelgfprnmftalfatarvvgwtahvieyvsdnklirptseyvgpmdveyipi
errde

Sequence, based on observed residues (ATOM records): (download)

>d2p2wa_ a.103.1.0 (A:) automated matches {Thermotoga maritima [TaxId: 2336]}
miqkglegvkicessicyldgingrlyyrgipveelaekstfeetayflwygklptksel
eefkrkmadyrelpaealgilyhlpknlhyidvlkiflsihedlrekairvasvfptila
yyyryskgkelirprkdlshvenfyymmfgernekirllesafillmeqdinastfaalv
iastlsdlyscivgalgalkgplhggasekvppmleeigsedrveefvqkclkekrkimg
fghrvyktydpravflkrvlqehfpdsklfriaskleeyivsnkikniypnvdlyssvlf
eelgfprnmftalfatarvvgwtahvieyvsdnklirptseyvgpmdveyipierrde

SCOPe Domain Coordinates for d2p2wa_:

Click to download the PDB-style file with coordinates for d2p2wa_.
(The format of our PDB-style files is described here.)

Timeline for d2p2wa_: