Lineage for d2p2oa_ (2p2o A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1806519Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 1806520Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) (S)
    superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
  5. 1806555Family b.81.1.3: Galactoside acetyltransferase-like [51168] (4 proteins)
    this is a repeat family; one repeat unit is 1kqa A:80-100 found in domain
  6. 1806622Protein automated matches [190704] (4 species)
    not a true protein
  7. 1806627Species Geobacillus kaustophilus [TaxId:235909] [187975] (1 PDB entry)
  8. 1806628Domain d2p2oa_: 2p2o A: [166965]
    automated match to d1ocxa_

Details for d2p2oa_

PDB Entry: 2p2o (more details), 1.74 Å

PDB Description: crystal structure of maltose transacetylase from geobacillus kaustophilus p2(1) crystal form
PDB Compounds: (A:) Maltose transacetylase

SCOPe Domain Sequences for d2p2oa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p2oa_ b.81.1.3 (A:) automated matches {Geobacillus kaustophilus [TaxId: 235909]}
ksekekmlaghlynpadlelvkererarrlvrlynetleteydkrtgllkelfgstgerl
fiepnfrcdygynihvgenffmnfdgvildvcevrigdhcfigpgvhiytathpldpher
nsgleygkpvvighnvwiggravinpgvtigdnaviasgavvtkdvpanavvggnpakvi
kwlk

SCOPe Domain Coordinates for d2p2oa_:

Click to download the PDB-style file with coordinates for d2p2oa_.
(The format of our PDB-style files is described here.)

Timeline for d2p2oa_: