Lineage for d2p2kd_ (2p2k D:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 943754Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 943755Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 943756Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 944267Protein automated matches [190035] (15 species)
    not a true protein
  7. 944316Species Canavalia gladiata [TaxId:3824] [187610] (5 PDB entries)
  8. 944321Domain d2p2kd_: 2p2k D: [166962]
    automated match to d1azda_
    complexed with ca, mn

Details for d2p2kd_

PDB Entry: 2p2k (more details), 1.98 Å

PDB Description: crystal structure of a lectin from canavalia gladiata seeds (cgl) in complex with man1-4man-ome
PDB Compounds: (D:) Canavalia gladiata lectin

SCOPe Domain Sequences for d2p2kd_:

Sequence, based on SEQRES records: (download)

>d2p2kd_ b.29.1.1 (D:) automated matches {Canavalia gladiata [TaxId: 3824]}
adtivaveldtypntdigdpnyphigidiksvrskktakwnmqngkvgtahiiynsvgkr
lsavvsypngdsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfdatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

Sequence, based on observed residues (ATOM records): (download)

>d2p2kd_ b.29.1.1 (D:) automated matches {Canavalia gladiata [TaxId: 3824]}
adtivaveldtypntdigdpnyphigidiksvrskktakwnmqngkvgtahiiynsvgkr
lsavvsypngdsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnet
nalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvhiwe
ssavvasfdatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

SCOPe Domain Coordinates for d2p2kd_:

Click to download the PDB-style file with coordinates for d2p2kd_.
(The format of our PDB-style files is described here.)

Timeline for d2p2kd_: