![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
![]() | Superfamily a.2.17: Endosomal sorting complex assembly domain [140111] (4 families) ![]() forms 'fan'-like heterooligomers, in which the domains of different subunit make similar interactions at the tip of the hairpin |
![]() | Family a.2.17.2: VPS28 N-terminal domain [140115] (2 proteins) includes structurally variable linker region |
![]() | Protein automated matches [191023] (1 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188820] (1 PDB entry) |
![]() | Domain d2p22b_: 2p22 B: [166951] automated match to d2f6mb1 complexed with so4 |
PDB Entry: 2p22 (more details), 2.7 Å
SCOPe Domain Sequences for d2p22b_:
Sequence, based on SEQRES records: (download)
>d2p22b_ a.2.17.2 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} klnqnqdisqlfhdevplfdnsitskdkevietlseiysivitldhvekaylkdsiddtq ytntvdkllkqfkvylnsqnkeeinkhfqsieafadtynitasnaitrler
>d2p22b_ a.2.17.2 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} klnqnqdisqlfhdevplfdnsitskdkevietlseiysivitldhvekaylkdsiddtq ytntvdkllkqfkvylnsqnkeesnaitrler
Timeline for d2p22b_: