Lineage for d2p22b_ (2p22 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2690696Superfamily a.2.17: Endosomal sorting complex assembly domain [140111] (4 families) (S)
    forms 'fan'-like heterooligomers, in which the domains of different subunit make similar interactions at the tip of the hairpin
  5. 2690706Family a.2.17.2: VPS28 N-terminal domain [140115] (2 proteins)
    includes structurally variable linker region
  6. 2690715Protein automated matches [191023] (1 species)
    not a true protein
  7. 2690716Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [188820] (1 PDB entry)
  8. 2690717Domain d2p22b_: 2p22 B: [166951]
    automated match to d2f6mb1
    complexed with so4

Details for d2p22b_

PDB Entry: 2p22 (more details), 2.7 Å

PDB Description: structure of the yeast escrt-i heterotetramer core
PDB Compounds: (B:) vacuolar protein sorting-associated protein 28

SCOPe Domain Sequences for d2p22b_:

Sequence, based on SEQRES records: (download)

>d2p22b_ a.2.17.2 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
klnqnqdisqlfhdevplfdnsitskdkevietlseiysivitldhvekaylkdsiddtq
ytntvdkllkqfkvylnsqnkeeinkhfqsieafadtynitasnaitrler

Sequence, based on observed residues (ATOM records): (download)

>d2p22b_ a.2.17.2 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
klnqnqdisqlfhdevplfdnsitskdkevietlseiysivitldhvekaylkdsiddtq
ytntvdkllkqfkvylnsqnkeesnaitrler

SCOPe Domain Coordinates for d2p22b_:

Click to download the PDB-style file with coordinates for d2p22b_.
(The format of our PDB-style files is described here.)

Timeline for d2p22b_: