SCOPe 2.06: Domain d2p1le_: 2p1l E:

Lineage for d2p1le_ (2p1l E:)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein Apoptosis regulator Bcl-xL [56856] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [56857] (35 PDB entries)

8. Domain d2p1le_: 2p1l E: [166947]
   automated match to d1g5ja_

Details for d2p1le_

PDB Entry: 2p1l, 2.5 Å

PDB Description: structure of the bcl-xl:beclin 1 complex

PDB Compounds: (E:) apoptosis regulator bcl-x

SCOPe Domain Sequences for d2p1le_:

Sequence; same for both SEQRES and ATOM records:

>d2p1le_ f.1.4.1 (E:) Apoptosis regulator Bcl-xL {Human (Homo sapiens) [TaxId: 9606]}
sqsnrelvvdflsyklsqkgyswsqmaavkqalreagdefelryrrafsdltsqlhitpg
tayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemqvlvsriaawmatylndh
lepwiqenggwdtfvelygnn

Timeline for d2p1le_:

• d2p1le_ first appeared in SCOPe 2.01
  
• d2p1le_ appears in SCOPe 2.05
  
• d2p1le_ appears in SCOPe 2.07
  
• d2p1le_ appears in the current release, SCOPe 2.08