Lineage for d2p1ba_ (2p1b A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1812227Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 1812356Superfamily b.121.3: Nucleoplasmin-like core domain [69203] (2 families) (S)
    oligomerizes into a pentameric ring structure
  5. 1812357Family b.121.3.1: Nucleoplasmin-like core domain [69204] (4 proteins)
    automatically mapped to Pfam PF03066
  6. 1812394Protein automated matches [190762] (3 species)
    not a true protein
  7. 1812406Species Human (Homo sapiens) [TaxId:9606] [187973] (1 PDB entry)
  8. 1812407Domain d2p1ba_: 2p1b A: [166935]
    automated match to d1xb9a_

Details for d2p1ba_

PDB Entry: 2p1b (more details), 2.75 Å

PDB Description: Crystal structure of human nucleophosmin-core
PDB Compounds: (A:) Nucleophosmin

SCOPe Domain Sequences for d2p1ba_:

Sequence, based on SEQRES records: (download)

>d2p1ba_ b.121.3.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qnylfgcelkadkdyhfkvdndenehqlslrtvslgagakdelhiveaeamnyegspikv
tlatlkmsvqptvslggfeitppvvlrlkcgsgpvhisgqhlva

Sequence, based on observed residues (ATOM records): (download)

>d2p1ba_ b.121.3.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qnylfgcelkadkdyhfkvdehqlslrtvslgagakdelhiveaeamnyegspikvtlat
lkmsvqptvslggfeitppvvlrlkcgsgpvhisgqhlva

SCOPe Domain Coordinates for d2p1ba_:

Click to download the PDB-style file with coordinates for d2p1ba_.
(The format of our PDB-style files is described here.)

Timeline for d2p1ba_: