Lineage for d2p0gc_ (2p0g C:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 991973Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 991974Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 993568Family c.47.1.23: Selenoprotein W-related [142411] (4 proteins)
    Pfam PF05169; "minimalized" version of the thioredoxin-like fold
  6. 993581Protein automated matches [190755] (4 species)
    not a true protein
  7. 993599Species Vibrio cholerae [TaxId:666] [187972] (1 PDB entry)
  8. 993602Domain d2p0gc_: 2p0g C: [166929]
    automated match to d2fa8a1

Details for d2p0gc_

PDB Entry: 2p0g (more details), 2.3 Å

PDB Description: crystal structure of selenoprotein w-related protein from vibrio cholerae. northeast structural genomics target vcr75
PDB Compounds: (C:) Selenoprotein W-related protein

SCOPe Domain Sequences for d2p0gc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p0gc_ c.47.1.23 (C:) automated matches {Vibrio cholerae [TaxId: 666]}
nkaqieiyycrqcnwmlrsawlsqellhtfseeieyvalhpdtggrfeifcngvqiwerk
qeggfpeakvlkqrvrdlid

SCOPe Domain Coordinates for d2p0gc_:

Click to download the PDB-style file with coordinates for d2p0gc_.
(The format of our PDB-style files is described here.)

Timeline for d2p0gc_: