Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.23: Selenoprotein W-related [142411] (4 proteins) Pfam PF05169; "minimalized" version of the thioredoxin-like fold |
Protein automated matches [190755] (4 species) not a true protein |
Species Vibrio cholerae [TaxId:666] [187972] (1 PDB entry) |
Domain d2p0gb_: 2p0g B: [166928] automated match to d2fa8a1 |
PDB Entry: 2p0g (more details), 2.3 Å
SCOPe Domain Sequences for d2p0gb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2p0gb_ c.47.1.23 (B:) automated matches {Vibrio cholerae [TaxId: 666]} nkaqieiyycrqcnwmlrsawlsqellhtfseeieyvalhpdtggrfeifcngvqiwerk qeggfpeakvlkqrvrdlid
Timeline for d2p0gb_: