Lineage for d2oxva_ (2oxv A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1371642Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest
  4. 1371643Superfamily c.52.1: Restriction endonuclease-like [52980] (34 families) (S)
  5. 1371644Family c.52.1.1: Restriction endonuclease EcoRI [52981] (2 proteins)
    automatically mapped to Pfam PF02963
  6. 1371656Protein automated matches [190876] (1 species)
    not a true protein
  7. 1371657Species Escherichia coli [TaxId:562] [188229] (1 PDB entry)
  8. 1371658Domain d2oxva_: 2oxv A: [166918]
    automated match to d1ckqa_
    protein/DNA complex; mutant

Details for d2oxva_

PDB Entry: 2oxv (more details), 1.95 Å

PDB Description: structure of the a138t promiscuous mutant of the ecori restriction endonuclease bound to its cognate recognition site.
PDB Compounds: (A:) Type II restriction enzyme EcoRI

SCOPe Domain Sequences for d2oxva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oxva_ c.52.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
sqgvigifgdyakahdlavgevsklvkkalsneypqlsfryrdsikkteinealkkidpd
lggtlfvsnssikpdggivevkddygewrvvlvaeakhqgkdiinirngllvgkrgdqdl
mtagnaiershkniseianfmlseshfpyvlflegsnfltenisitrpdgrvvnleynsg
ilnrldrltaanygmpinsnlcinkfvnhkdksimlqaasiytqgdgrewdskimfeimf
disttslrvlgrdlfeqltsk

SCOPe Domain Coordinates for d2oxva_:

Click to download the PDB-style file with coordinates for d2oxva_.
(The format of our PDB-style files is described here.)

Timeline for d2oxva_: