Lineage for d2oxtb_ (2oxt B:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 999457Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 999458Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 1000528Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 1000529Protein automated matches [190689] (17 species)
    not a true protein
  7. 1000573Species Meaban virus [TaxId:35279] [188819] (1 PDB entry)
  8. 1000575Domain d2oxtb_: 2oxt B: [166915]
    automated match to d1l9ka_
    complexed with sam

Details for d2oxtb_

PDB Entry: 2oxt (more details), 2.9 Å

PDB Description: Crystal structure of Meaban virus nucleoside-2'-O-methyltransferase
PDB Compounds: (B:) nucleoside-2'-o-methyltransferase

SCOPe Domain Sequences for d2oxtb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oxtb_ c.66.1.0 (B:) automated matches {Meaban virus [TaxId: 35279]}
gpgstgaslgmmwkdklnamtkeeftrykragvmetdrkeardylkrgdgktglsvsrgt
aklawmeergyveltgrvvdlgcgrggwsyyaasrphvmdvraytlgvgghevpritesy
gwnivkfksrvdihtlpvertdvimcdvgesspkwsvesertikilellekwkvknpsad
fvvkvlcpysvevmerlsvmqrkwggglvrnpysrnsthemyftsraggniigavtacte
rllgrmarrdgpvvvpelnlgtgtr

SCOPe Domain Coordinates for d2oxtb_:

Click to download the PDB-style file with coordinates for d2oxtb_.
(The format of our PDB-style files is described here.)

Timeline for d2oxtb_: