Lineage for d2oxta_ (2oxt A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2894468Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2894469Protein automated matches [190689] (87 species)
    not a true protein
  7. 2894825Species Meaban virus [TaxId:35279] [188819] (1 PDB entry)
  8. 2894826Domain d2oxta_: 2oxt A: [166914]
    automated match to d1l9ka_
    complexed with sam

Details for d2oxta_

PDB Entry: 2oxt (more details), 2.9 Å

PDB Description: Crystal structure of Meaban virus nucleoside-2'-O-methyltransferase
PDB Compounds: (A:) nucleoside-2'-o-methyltransferase

SCOPe Domain Sequences for d2oxta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oxta_ c.66.1.0 (A:) automated matches {Meaban virus [TaxId: 35279]}
gpgstgaslgmmwkdklnamtkeeftrykragvmetdrkeardylkrgdgktglsvsrgt
aklawmeergyveltgrvvdlgcgrggwsyyaasrphvmdvraytlgvgghevpritesy
gwnivkfksrvdihtlpvertdvimcdvgesspkwsvesertikilellekwkvknpsad
fvvkvlcpysvevmerlsvmqrkwggglvrnpysrnsthemyftsraggniigavtacte
rllgrmarrdgpvvvpelnlgtgtr

SCOPe Domain Coordinates for d2oxta_:

Click to download the PDB-style file with coordinates for d2oxta_.
(The format of our PDB-style files is described here.)

Timeline for d2oxta_: