SCOPe 2.08: Domain d2oxqb1: 2oxq B:1-147

Lineage for d2oxqb1 (2oxq B:1-147)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein automated matches [190124] (13 species)
   not a true protein

7. Species Zebrafish (Danio rerio) [TaxId:7955] [188346] (1 PDB entry)

8. Domain d2oxqb1: 2oxq B:1-147 [166913]
   Other proteins in same PDB: d2oxqa2, d2oxqb2, d2oxqc_, d2oxqd_
   automated match to d1ur6a_
   complexed with cl

Details for d2oxqb1

PDB Entry: 2oxq, 2.9 Å

PDB Description: Structure of the UbcH5 :CHIP U-box complex

PDB Compounds: (B:) Ubiquitin-conjugating enzyme E2D 1

SCOPe Domain Sequences for d2oxqb1:

Sequence; same for both SEQRES and ATOM records:

>d2oxqb1 d.20.1.1 (B:1-147) automated matches {Zebrafish (Danio rerio) [TaxId: 7955]}
malkriqkelqdlqrdppaqcsagpvgddlfhwqatimgpsdspyqggvffltihfptdy
pfkppkvafttkiyhpninsngsicldilrsqwspaltvskvllsicsllcdpnpddplv
pdiahiyksdkekynrlarewtqkyam

Timeline for d2oxqb1:

• d2oxqb1 first appeared in SCOPe 2.01, called d2oxqb_
  
• d2oxqb1 appears in SCOPe 2.07