SCOPe 2.08: Domain d2oxna1: 2oxn A:1-330

Lineage for d2oxna1 (2oxn A:1-330)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.7: NagZ-like [51553] (4 proteins)
   Pfam PF00933; Glycosyl hydrolase family 3 domain
   Some members have reversed beta strand compared to other members of fold

6. Protein Beta-hexosaminidase NagZ [117370] (1 species)

7. Species Vibrio cholerae [TaxId:666] [117371] (3 PDB entries)
   Uniprot Q9KU37

8. Domain d2oxna1: 2oxn A:1-330 [166910]
   Other proteins in same PDB: d2oxna2
   automated match to d1tr9a_
   complexed with oan

Details for d2oxna1

PDB Entry: 2oxn, 1.7 Å

PDB Description: Vibrio cholerae family 3 glycoside hydrolase (NagZ) in complex with PUGNAc

PDB Compounds: (A:) Beta-hexosaminidase

SCOPe Domain Sequences for d2oxna1:

Sequence; same for both SEQRES and ATOM records:

>d2oxna1 c.1.8.7 (A:1-330) Beta-hexosaminidase NagZ {Vibrio cholerae [TaxId: 666]}
mgplwldvagyelsaedreilqhptvggvilfgrnyhdnqqllalnkairqaakrpilig
vdqeggrvqrfregfsrippaqyyaraengvelaeqggwlmaaeliahdvdlsfapvldm
gfackaignrafgedvqtvlkhssaflrgmkavgmattgkhfpghgaviadshletpyde
retiaqdmaifraqieagvldammpahvvyphydaqpasgssywlkqvlreelgfkgivf
sddlsmegaavmggpvershqalvagcdmilicnkreaavevldnlpimevpqaeallkk
qqfsyselkrlerwqqasanmqrlieqfse

Timeline for d2oxna1:

• d2oxna1 first appeared in SCOPe 2.01, called d2oxna_
  
• d2oxna1 appears in SCOPe 2.07