Class a: All alpha proteins [46456] (226 folds) |
Fold a.25: Ferritin-like [47239] (2 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (3 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (7 proteins) |
Protein (Apo)ferritin [47246] (5 species) |
Species Bullfrog (Rana catesbeiana) [TaxId:8400] [47249] (7 PDB entries) |
Domain d1rce__: 1rce - [16691] complexed with bet; mutant |
PDB Entry: 1rce (more details), 2.4 Å
SCOP Domain Sequences for d1rce__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1rce__ a.25.1.1 (-) (Apo)ferritin {Bullfrog (Rana catesbeiana)} sqvrqnfhqdceaglnrtvnlkfhssyvylsmasyfnrddvalsnfakffrersaaakah aeklieyqnqrggrvflqsvekperddwanglealqtalklqksvnqalldlhavaadks dphmtdflespylsesvetikklgdhitslkklwsshpgmaeylfnkhtlg
Timeline for d1rce__: