| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
| Protein automated matches [190226] (81 species) not a true protein |
| Species Paracoccus denitrificans [TaxId:266] [187968] (3 PDB entries) |
| Domain d2oxhz_: 2oxh Z: [166909] automated match to d1v8ha1 complexed with edo |
PDB Entry: 2oxh (more details), 2.35 Å
SCOPe Domain Sequences for d2oxhz_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2oxhz_ b.1.18.0 (Z:) automated matches {Paracoccus denitrificans [TaxId: 266]}
addakprvkvpssakagetvtvkalishkmesgqrkdadgkliprsiinrftcelngvnv
vdvaidpavstnpyfefdakvdaagefkftwydddgsvyedvkpiav
Timeline for d2oxhz_: