Lineage for d2oxgc_ (2oxg C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766140Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2766141Protein automated matches [190226] (81 species)
    not a true protein
  7. 2766485Species Paracoccus denitrificans [TaxId:266] [187968] (3 PDB entries)
  8. 2766487Domain d2oxgc_: 2oxg C: [166903]
    automated match to d1v8ha1
    complexed with edo, so4

Details for d2oxgc_

PDB Entry: 2oxg (more details), 1.4 Å

PDB Description: The SoxYZ Complex of Paracoccus pantotrophus
PDB Compounds: (C:) SoxZ protein

SCOPe Domain Sequences for d2oxgc_:

Sequence, based on SEQRES records: (download)

>d2oxgc_ b.1.18.0 (C:) automated matches {Paracoccus denitrificans [TaxId: 266]}
addakprvkvpssakagetvtvkalishkmesgqrkdadgkliprsiinrftcelngvnv
vdvaidpavstnpyfefdakvdaagefkftwydddgsvyedvkpiav

Sequence, based on observed residues (ATOM records): (download)

>d2oxgc_ b.1.18.0 (C:) automated matches {Paracoccus denitrificans [TaxId: 266]}
addakprvkvpssakagetvtvkalishkmesgqrkiprsiinrftcelngvnvvdvaid
pavstnpyfefdakvdaagefkftwydddgsvyedvkpiav

SCOPe Domain Coordinates for d2oxgc_:

Click to download the PDB-style file with coordinates for d2oxgc_.
(The format of our PDB-style files is described here.)

Timeline for d2oxgc_: