Lineage for d2oxga_ (2oxg A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2375023Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2376005Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2376006Protein automated matches [190226] (72 species)
    not a true protein
  7. 2376301Species Paracoccus denitrificans [TaxId:266] [187968] (3 PDB entries)
  8. 2376302Domain d2oxga_: 2oxg A: [166902]
    automated match to d1v8ha1
    complexed with edo, so4

Details for d2oxga_

PDB Entry: 2oxg (more details), 1.4 Å

PDB Description: The SoxYZ Complex of Paracoccus pantotrophus
PDB Compounds: (A:) SoxZ protein

SCOPe Domain Sequences for d2oxga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2oxga_ b.1.18.0 (A:) automated matches {Paracoccus denitrificans [TaxId: 266]}
addakprvkvpssakagetvtvkalishkmesgqrkdadgkliprsiinrftcelngvnv
vdvaidpavstnpyfefdakvdaagefkftwydddgsvyedvkpiava

SCOPe Domain Coordinates for d2oxga_:

Click to download the PDB-style file with coordinates for d2oxga_.
(The format of our PDB-style files is described here.)

Timeline for d2oxga_: