Lineage for d1rcc__ (1rcc -)

  1. Root: SCOP 1.57
  2. 43951Class a: All alpha proteins [46456] (144 folds)
  3. 46712Fold a.25: Ferritin-like [47239] (1 superfamily)
  4. 46713Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
  5. 46714Family a.25.1.1: Ferritin [47241] (5 proteins)
  6. 46715Protein (Apo)ferritin [47246] (4 species)
  7. 46716Species Bullfrog (Rana catesbeiana) [TaxId:8400] [47249] (7 PDB entries)
  8. 46721Domain d1rcc__: 1rcc - [16690]

Details for d1rcc__

PDB Entry: 1rcc (more details), 2.4 Å

PDB Description: bullfrog red cell l ferritin tartrate/mg/ph 5.5

SCOP Domain Sequences for d1rcc__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rcc__ a.25.1.1 (-) (Apo)ferritin {Bullfrog (Rana catesbeiana)}
sqvrqnfhqdceaglnrtvnlkfhssyvylsmasyfnrddvalsnfakffrersaaakah
aeklieyqnqrggrvflqsvekperddwanglealqtalklqksvnqalldlhavaadks
dphmtdflespylsesvetikklgdhitslkklwsshpgmaeylfnkhtlg

SCOP Domain Coordinates for d1rcc__:

Click to download the PDB-style file with coordinates for d1rcc__.
(The format of our PDB-style files is described here.)

Timeline for d1rcc__: