Lineage for d2ox9a_ (2ox9 A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2558905Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2558906Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2559681Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2559682Protein automated matches [190159] (19 species)
    not a true protein
  7. 2559977Species Mouse (Mus musculus) [TaxId:10090] [187331] (27 PDB entries)
  8. 2559986Domain d2ox9a_: 2ox9 A: [166896]
    automated match to d1t8ca1
    complexed with ca

Details for d2ox9a_

PDB Entry: 2ox9 (more details), 1.95 Å

PDB Description: mouse scavenger receptor c-type lectin carbohydrate-recognition domain.
PDB Compounds: (A:) Collectin placenta 1

SCOPe Domain Sequences for d2ox9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ox9a_ d.169.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gcpphwknftdkcyyfslekeifedaklfcedksshlvfinsreeqqwikkhtvgreshw
igltdseqesewkwldgspvdyknwkagqpdnwgsghgpgedcagliyagqwndfqcdei
nnficekere

SCOPe Domain Coordinates for d2ox9a_:

Click to download the PDB-style file with coordinates for d2ox9a_.
(The format of our PDB-style files is described here.)

Timeline for d2ox9a_: