Lineage for d2ox8d_ (2ox8 D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2607278Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2607279Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2608201Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2608202Protein automated matches [190159] (20 species)
    not a true protein
  7. 2608257Species Human (Homo sapiens) [TaxId:9606] [186882] (106 PDB entries)
  8. 2608500Domain d2ox8d_: 2ox8 D: [166895]
    automated match to d1dv8a_
    complexed with ca, cl, zn

Details for d2ox8d_

PDB Entry: 2ox8 (more details), 2.5 Å

PDB Description: Human Scavenger Receptor C-type Lectin carbohydrate-recognition domain.
PDB Compounds: (D:) Scavenger receptor with C-type lectin type I

SCOPe Domain Sequences for d2ox8d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ox8d_ d.169.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
scpphwknftdkcyyfsvekeifedaklfcedksshlvfintreeqqwikkqmvgreshw
igltdserenewkwldgtspdyknwkagqpdnwghghgpgedcagliyagqwndfqcedv
nnficekdr

SCOPe Domain Coordinates for d2ox8d_:

Click to download the PDB-style file with coordinates for d2ox8d_.
(The format of our PDB-style files is described here.)

Timeline for d2ox8d_: