![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
![]() | Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
![]() | Protein automated matches [190226] (81 species) not a true protein |
![]() | Species Paracoccus denitrificans [TaxId:266] [187968] (3 PDB entries) |
![]() | Domain d2ox5z_: 2ox5 Z: [166891] automated match to d1v8ha1 complexed with act, edo, so4 |
PDB Entry: 2ox5 (more details), 1.98 Å
SCOPe Domain Sequences for d2ox5z_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ox5z_ b.1.18.0 (Z:) automated matches {Paracoccus denitrificans [TaxId: 266]} addakprvkvpssakagetvtvkalishkmesgqrkdadgkliprsiinrftcelngvnv vdvaidpavstnpyfefdakvdaagefkftwydddgsvyedvkpiava
Timeline for d2ox5z_: