Lineage for d1rcg__ (1rcg -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 2448Fold a.25: Ferritin-like [47239] (1 superfamily)
  4. 2449Superfamily a.25.1: Ferritin-like [47240] (2 families) (S)
  5. 2450Family a.25.1.1: Ferritin [47241] (4 proteins)
  6. 2451Protein (Apo)ferritin [47246] (3 species)
  7. 2452Species Bullfrog (Rana catesbeiana) [TaxId:8400] [47249] (7 PDB entries)
  8. 2456Domain d1rcg__: 1rcg - [16689]

Details for d1rcg__

PDB Entry: 1rcg (more details), 2.2 Å

PDB Description: bullfrog red cell l ferritin sulfate/mn/ph 6.3

SCOP Domain Sequences for d1rcg__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rcg__ a.25.1.1 (-) (Apo)ferritin {Bullfrog (Rana catesbeiana)}
sqvrqnfhqdceaglnrtvnlkfhssyvylsmasyfnrddvalsnfakffrerseeekeh
aeklieyqnqrggrvflqsvekperddwanglealqtalklqksvnqalldlhavaadks
dphmtdflespylsesvetikklgdhitslkklwsshpgmaeylfnkhtlg

SCOP Domain Coordinates for d1rcg__:

Click to download the PDB-style file with coordinates for d1rcg__.
(The format of our PDB-style files is described here.)

Timeline for d1rcg__: