SCOPe 2.02: Domain d2owwa_: 2oww A:

Lineage for d2owwa_ (2oww A:)

1. Root: SCOPe 2.02

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein automated matches [190099] (3 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:274] [188525] (3 PDB entries)

8. Domain d2owwa_: 2oww A: [166886]
   automated match to d1cwya_
   complexed with acr, g4d, gol, mli

Details for d2owwa_

PDB Entry: 2oww, 2.2 Å

PDB Description: covalent intermediate in amylomaltase in complex with the acceptor analog 4-deoxyglucose

PDB Compounds: (A:) 4-alpha-glucanotransferase

SCOPe Domain Sequences for d2owwa_:

Sequence; same for both SEQRES and ATOM records:

>d2owwa_ c.1.8.1 (A:) automated matches {Thermus thermophilus [TaxId: 274]}
melprafglllhptslpgpygvgvlgqeardflrflkeaggrywqvlplgptgygdspyq
sfsafagnpylidlrplaergyvrledpgfpqgrvdygllyawkwpalkeafrgfkekas
peereafaafrereawwledyalfmalkgahgglpwnrwplplrkreekalreaksalae
evafhaftqwlffrqwgalkaeaealgiriigdmpifvaedsaevwahpewfhldeegrp
tvvagvppdyfsetgqrwgnplyrwdvleregfsfwirrlekalelfhlvridhfrgfea
yweipascptavegrwvkapgeklfqkiqevfgevpvlaedlgvitpevealrdrfglpg
mkvlqfafddgmenpflphnypahgrvvvytgthdndttlgwyrtatphekafmarylad
wgitfreeeevpwalmhlgmksvarlavypvqdvlalgsearmnypgrpsgnwawrllpg
elspehgarlramaeaterl

Timeline for d2owwa_:

• d2owwa_ first appeared in SCOPe 2.01
  
• d2owwa_ appears in SCOPe 2.03
  
• d2owwa_ appears in the current release, SCOPe 2.08, called d2owwa1