SCOPe 2.08: Domain d1rcia_: 1rci A:

Lineage for d1rcia_ (1rci A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein (Apo)ferritin [47246] (8 species)

7. Species Bullfrog (Rana catesbeiana) [TaxId:8400] [47249] (21 PDB entries)

8. Domain d1rcia_: 1rci A: [16688]
   complexed with bet

Details for d1rcia_

PDB Entry: 1rci, 2 Å

PDB Description: bullfrog red cell l ferritin tartrate/mg/ph 5.5

PDB Compounds: (A:) l ferritin

SCOPe Domain Sequences for d1rcia_:

Sequence; same for both SEQRES and ATOM records:

>d1rcia_ a.25.1.1 (A:) (Apo)ferritin {Bullfrog (Rana catesbeiana) [TaxId: 8400]}
sqvrqnfhqdceaglnrtvnlkfyssyvylsmasyfnrddvalsnfakffrerseeekeh
aeklieyqnqrggrvflqsvekperddwanglealqtalklqksvnqalldlhavaadks
dphmtdflespylsesvetikklgdhitslkklwsshpgmaeylfnkhtlg

Timeline for d1rcia_:

• d1rcia_ first appeared (with stable ids) in SCOP 1.55, called d1rci__
  
• d1rcia_ appears in SCOPe 2.07