Lineage for d2owca_ (2owc A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1818156Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1818157Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 1818647Protein automated matches [190099] (22 species)
    not a true protein
  7. 1818791Species Thermus thermophilus [TaxId:274] [188525] (3 PDB entries)
  8. 1818792Domain d2owca_: 2owc A: [166873]
    automated match to d1cwya_
    complexed with acr, gol, mli

Details for d2owca_

PDB Entry: 2owc (more details), 2.05 Å

PDB Description: structure of a covalent intermediate in thermus thermophilus amylomaltase
PDB Compounds: (A:) 4-alpha-glucanotransferase

SCOPe Domain Sequences for d2owca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2owca_ c.1.8.1 (A:) automated matches {Thermus thermophilus [TaxId: 274]}
melprafglllhptslpgpygvgvlgqeardflrflkeaggrywqvlplgptgygdspyq
sfsafagnpylidlrplaergyvrledpgfpqgrvdygllyawkwpalkeafrgfkekas
peereafaafrereawwledyalfmalkgahgglpwnrwplplrkreekalreaksalae
evafhaftqwlffrqwgalkaeaealgiriigdmpifvaedsaevwahpewfhldeegrp
tvvagvppdyfsetgqrwgnplyrwdvleregfsfwirrlekalelfhlvridhfrgfea
yweipascptavegrwvkapgeklfqkiqevfgevpvlaedlgvitpevealrdrfglpg
mkvlqfafddgmenpflphnypahgrvvvytgthdndttlgwyrtatphekafmarylad
wgitfreeeevpwalmhlgmksvarlavypvqdvlalgsearmnypgrpsgnwawrllpg
elspehgarlramaeaterl

SCOPe Domain Coordinates for d2owca_:

Click to download the PDB-style file with coordinates for d2owca_.
(The format of our PDB-style files is described here.)

Timeline for d2owca_: