Lineage for d2ow4a_ (2ow4 A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2373041Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2373586Protein automated matches [190035] (28 species)
    not a true protein
  7. 2373682Species Canavalia maritima [TaxId:3825] [187574] (6 PDB entries)
  8. 2373685Domain d2ow4a_: 2ow4 A: [166872]
    automated match to d1apna_
    complexed with ca, man, mma, mn

Details for d2ow4a_

PDB Entry: 2ow4 (more details), 1.6 Å

PDB Description: crystal structure of a lectin from canavalia maritima seeds (conm) in complex with man1-2man-ome
PDB Compounds: (A:) Canavalia maritima lectin

SCOPe Domain Sequences for d2ow4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ow4a_ b.29.1.1 (A:) automated matches {Canavalia maritima [TaxId: 3825]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvgkr
lsavvsypngdsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfsfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfdatftflikssdshpadgiaffisnidssipsgstgrllglfpdan

SCOPe Domain Coordinates for d2ow4a_:

Click to download the PDB-style file with coordinates for d2ow4a_.
(The format of our PDB-style files is described here.)

Timeline for d2ow4a_: