Lineage for d2ovua_ (2ovu A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2373041Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2373586Protein automated matches [190035] (28 species)
    not a true protein
  7. 2373654Species Canavalia gladiata [TaxId:3824] [187610] (5 PDB entries)
  8. 2373655Domain d2ovua_: 2ovu A: [166871]
    automated match to d1apna_
    complexed with ca, man, mma, mn

Details for d2ovua_

PDB Entry: 2ovu (more details), 1.5 Å

PDB Description: crystal structure of a lectin from canavalia gladiata (cgl) in complex with man1-2man-ome
PDB Compounds: (A:) Canavalia gladiata lectin

SCOPe Domain Sequences for d2ovua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ovua_ b.29.1.1 (A:) automated matches {Canavalia gladiata [TaxId: 3824]}
adtivaveldtypntdigdpdyphigidiksvrskktakwnmqngkvgtahiiynsvgkr
lsavvsypngdsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfdatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

SCOPe Domain Coordinates for d2ovua_:

Click to download the PDB-style file with coordinates for d2ovua_.
(The format of our PDB-style files is described here.)

Timeline for d2ovua_: