SCOPe 2.08: Domain d2ovga_: 2ovg A:

Lineage for d2ovga_ (2ovg A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.2: Phage repressors [47419] (7 proteins)
   consists of different sequence families of HTH repressors of phage origins

6. Protein cro lambda repressor [47428] (1 species)
   the fourth helix is replaced with a beta hairpin
   3 helices; folded leaf, opened

7. Species Bacteriophage lambda [TaxId:10710] [47429] (12 PDB entries)

8. Domain d2ovga_: 2ovg A: [166870]
   automated match to d1copd_
   complexed with epe, so4; mutant
   heterogeneous fold; applies to domains that adopt a different fold than the exemplar domain but has similar sequence and number of secondary structures

Details for d2ovga_

PDB Entry: 2ovg, 1.35 Å

PDB Description: lambda cro q27p/a29s/k32q triple mutant at 1.35 a in space group p3221

PDB Compounds: (A:) Phage lambda Cro

SCOPe Domain Sequences for d2ovga_:

Sequence; same for both SEQRES and ATOM records:

>d2ovga_ a.35.1.2 (A:) cro lambda repressor {Bacteriophage lambda [TaxId: 10710]}
qritlkdyamrfgqtktakdlgvypssinqaihagrkifltinadgsvyaeevkpfps

Timeline for d2ovga_:

• d2ovga_ first appeared in SCOPe 2.01
  
• d2ovga_ appears in SCOPe 2.07